ARMC4 (Armadillo Repeat Containing 4, DKFZp434P1735, FLJ10376, FLJ10817, FLJ32798, RP11-691I13.1)

Size

£698.00

SKU:: 243495
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: ARMC4 (NP_060546, 945aa-1044aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5F1
Format:: Supplied as a liquid.
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ARMC4. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEMouse monoclonal antibody raised against a partial recombinant ARMC4.GCISNIRRLALATEKARYT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.