243475-ML550

ARL13B (ADP-Ribosylation Factor-like 13B, ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, JBTS8, MGC120611, MGC120612) (MaxLight 550)

Size

£914.00

SKU:: 243475-ML550
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa329-428 of human ARL13B with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6F11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Extra Details:: MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Mouse monoclonal antibody raised against a partial recombinant ARL13B. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.