243462
ARHGEF11 (Rho Guanine Nucleotide Exchange Factor (GEF) 11, DKFZp667F1223, GTRAP48, KIAA0380, PDZ-RHOGEF)
Size
£685.00
- SKU:
- 243462
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- ARHGEF11 (AAH57394, 651aa-750aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2H7
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. A similar protein in rat interacts with glutamate transporter EAAT4 and modulates its glutamate transport activity. Expression of the rat protein induces the reorganization of the actin cytoskeleton and its overexpression induces the formation of membrane ruffling and filopodia. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RSESLKGREEMKRSRKAENVPRSRSDVDMDMouse monoclonal antibody raised against a partial recombinant ARHGEF11.EATRLHQSASSSTSSLSTRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice