APLN (Apelin, XNPEP2)

Size

£685.00

SKU:: 243402
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: APLN (AAH21104, 1aa-77aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B6
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Apelin is a neuropeptide expressed in the supraoptic and paraventricular nuclei that acts on specific receptors located on vasopressinergic neurons (De Mota et al., 2004) [PubMed 15231996].[supplied by OMIM Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.