AKR1D1 (aldo-keto Reductase Family 1, Member D1 (delta 4-3-ketosteroid-5-beta-Reductase), 3o5bred, SRD5B1)

Size

£685.00

SKU:: 243213
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: AKR1D1 (NP_005980, 227aa-326aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A6
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.