AKR1B10 (aldo-keto Reductase Family 1, Member B10 (aldose Reductase), AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI, MGC14103)

Size

£685.00

SKU:: 243201
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: AKR1B10 (NP_064695, 76aa-143aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B3
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.