AGR2 (anterior gradient Homolog 2 (Xenopus laevis), AG2, GOB-4, HAG-2, XAG-2)

Size

£698.00

SKU:: 243149
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: AGR2 (AAH15503.1, 1aa-175aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 100000
Format:: Supplied as a liquid.
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant AGR2. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.