β-Amyloid

Size

£716.00

SKU:: 214485
Purity:: ~100% (HPLC)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder. No preservative added. Reconsitute with 1ml ddH2O.
Extra Details:: Beta amyloid 40, a major component of amyloid plaque Source: Synthetic peptide corresponding to aa1-40 of human amyloid beta protein. Uniprot Number: P05067 Amino Acid Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVVGGVV Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.