207942

TRIM49 (Tripartite Motif-containing 49, Ring Finger Protein 18, Testis-specific RING Finger Protein, RNF18)

Size

£685.00

SKU:: 207942
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa251-340 from human TRIM49 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This gene has been found to be preferentially expressed in testis. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.