207937-PE

TRIM23 (Tripartite Motif-containing 23, ARD1, ARFD1, RNF46, ADP-ribosylation Factor Domain Protein 1, ADP-ribosylation Factor Domain Protein 1, 64kD, ARF Domain Protein 1, GTP-Binding Protein ARD-1, OTTHUMP00000123453, Tripartite Motif Protein TRIM23) (PE)

Size

£914.00

SKU:: 207937-PE
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-110 from human TRIM23 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein is also a member of the ADP ribosylation factor family of guanine nucleotide-binding family of proteins. Its carboxy terminus contains an ADP-ribosylation factor domain and a guanine nucleotide binding site, while the amino terminus contains a GTPase activating protein domain which acts on the guanine nucleotide binding site. The protein localizes to lysosomes and the Golgi apparatus. It plays a role in the formation of intracellular transport vesicles, their movement from one compartment to another, and phopholipase D activation. Three alternatively spliced transcript variants for this gene have been described. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCED VFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPF DRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQY Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice