207913
TCL1A (T-Cell Leukemia/lymphoma 1A, T-Cell Lymphoma-1, T-Cell Lymphoma-1A, TCL1)
Size
£685.00
- SKU:
- 207913
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa61-114 from human TCL1A with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2F1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice