207911-ML550
TAOK2 (TAO Kinase 2, KIAA0881, MAP3K17, PSK, PSK1, TAO1, TAO2) (MaxLight 550)
Size
£914.00
- SKU:
- 207911-ML550
- Purity:
- Purified
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa831-930 from human TAOK2 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3E2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. TAO kinase 2 (Serine/threonine-protein kinase TAO2) belongs to the MAP kinase family. It activates the JNK MAP kinase pathway through the specific activation of the MAP2Ks MEK3 and MEK6. TAO kinase 2 mediates signaling from carbachol, relaying signals from carbachol through heterotrimeric G proteins to the p38 MAP kinase and ternary complex factors. It alters actin cytoskeletal organization and interacts with microtubules affecting their organization and stability independently of TAO kinase activity. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice