207838-BIOTIN

PIM1 (Pim-1 Oncogene, OTTHUMP00000018046, Oncogene PIM1, Non-specific serine/threonine Protein Kinase, Pim-1 Kinase 44kD isoform, Pim-1 Oncogene (proviral integration site 1), PIM) (Biotin)

Size

£914.00

SKU:: 207838-BIOTIN
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-100 from human PIM1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: The protooncogene PIM1 encodes a protein kinase upregulated in prostate cancer (Dhanasekaran et al., 2001 [PubMed 11518967]). Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGF Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.