207812

NEK4 (Never in Mitosis A-related Kinase 4, NimA-related Protein Kinase 4, Serine/Threonine Kinase 2, Serine/Threonine Protein Kinase-2, MGC33171, NRK2, STK2, PP12301)

Size

£685.00

SKU:: 207812
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa680-781 from human NEK4 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E9
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Seems to act exclusively upon threonine residues By similarity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVSVSLTVSRCLCYRIF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.