207800-HRP

MPG (N-methylpurine-DNA Glycosylase, 3' End of the Mid1 Gene, Localized 68kb Upstream the humanzeta Globin Gene on 16p, CRA36.1 (3-methyl-adenine DNA Glycosylase),N-methylpurine-DNA Glycosylase, MPG, Alkyladenine DNA Glycosylase, Proliferation-inducing Protein 11, Proliferation-inducing Protein, AAG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16) (HRP)

Size

£914.00

SKU:: 207800-HRP
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-90 from human MPG with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.