207800-APC

MPG (N-methylpurine-DNA Glycosylase, 3' End of the Mid1 Gene, Localized 68kb Upstream the humanzeta Globin Gene on 16p, CRA36.1 (3-methyl-adenine DNA Glycosylase),N-methylpurine-DNA Glycosylase, MPG, Alkyladenine DNA Glycosylase, Proliferation-inducing Protein 11, Proliferation-inducing Protein, AAG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16) (APC)

Size

£927.00

SKU:: 207800-APC
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-90 from human MPG with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B12
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions. Applications: Suitable for use in FLISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.