207798-BIOTIN

MPG (N-methylpurine-DNA Glycosylase, 3' End of the Mid1 Gene, Localized 68kb Upstream the humanzeta Globin Gene on 16p, CRA36.1 (3-methyl-adenine DNA Glycosylase),N-methylpurine-DNA Glycosylase, MPG, Alkyladenine DNA Glycosylase, Proliferation-inducing Protein 11, Proliferation-inducing Protein, AAG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16) (Biotin)

Size

£914.00

SKU:: 207798-BIOTIN
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-90 from human MPG with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.