207794-BIOTIN
MEOX2 (Mesenchyme Homeobox 2, Growth arrest-specific Homeo box, Mesenchyme Homeo box 2 (Growth arrest-specific Homeo box), GAX, MOX2) (Biotin)
Size
£914.00
- SKU:
- 207794-BIOTIN
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa1-303 from full-length human MEOX2 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4B2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHM SYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHH HHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLC LQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAP GDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKSE VNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEI AVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAR EKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSH DSDHSSEHAHL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice