207752-BIOTIN

KLF9 (Kruppel-like Factor 9, BTEB, BTEB1, OTTHUMP00000021441, Basic Transcription Element Binding Protein 1) (Biotin)

Size

£914.00

SKU:: 207752-BIOTIN
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa25-101 from human KLF9 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTL VTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSD VTT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.