207751-HRP

KLF6 (Kruppel-like Factor 6, B-cell derived 1, Core promoter Element Binding Protein, Core Promoter Element-Binding Protein, N-terminus truncated, Prostate Adenocarcinoma-1, Protooncogene BCD1, Suppression of tumorigenicity 12 (prostate), BCD1, COPEB, CPBP, DKFZp686N0199, GBF, PAC1, ST12, ZF9) (HRP)

Size

£914.00

SKU:: 207751-HRP
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-100 from human KLF6 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLE LERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEES ELKISSSPPEDTLISPSFCYNLE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice