207690

GUK1 (Guanylate Kinase 1, GMK, OTTHUMP00000037504, OTTHUMP00000037740, OTTHUMP00000037741, OTTHUMP00000037742, OTTHUMP00000037748, OTTHUMP00000037750, OTTHUMP00000061419)

Size

£698.00

SKU:: 207690
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa100-197 from human GUK1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1H3
Format:: Supplied as a liquid.
Extra Details:: Essential for recycling GMP and indirectly, cGMP. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.