207666
Glucagon (GCG, Glicentin-related polypeptide, Glucagon-like Peptide 1, Glucagon-like Peptide 2, GLP1, GLP2, GRPP)
Size
£685.00
- SKU:
- 207666
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa1-180 from full-length human Glucagon with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1E2-E6
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQ ADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQD FVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSY LEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHA DGSFSDEMNTILDNLAARDFINWLIQTKITDRK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice