207650

FYN (FYN Oncogene Related to SRC, FGR, YES, OKT3-induced Calcium Influx Regulator, OTTHUMP00000017914, OTTHUMP00000017915, OTTHUMP00000017917, C-syn protoOncogene, Protein-Tyrosine Kinase fyn, Proto-Oncogene Tyrosine-Protein Kinase fyn, Src-like Kinase, Src/yes-Related novel, Tyrosine Kinase p59fyn(T), MGC45350, SLK, SYN)

Size

£685.00

SKU:: 207650
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-90 from human FYN with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3A8
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTP QHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHT GTLRTRGGTGVTLFVAL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.