207608

FHIT (Fragile Histidine Triad Gene, AP3A Hydrolase,bis(5'-adenosyl)-triphosphatase, Diadenosine 5',5'''-P1,P3-triphosphate Hydrolase, Dinucleosidetriphosphatase, Tumor Suppressor Protein, AP3Aase, FRA3B)

Size

£698.00

SKU:: 207608
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa31-130 from human FHIT with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A2
Format:: Supplied as a liquid.
Extra Details:: This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGT VVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRK AGDFHRNDSIYEELQKHDKEDFPASWR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.