207604-BIOTIN

FASLG (Fas Ligand (TNF Superfamily, Member 6), APT1LG1, CD178, CD95L, FASL, TNFSF6, CD95 Ligand, OTTHUMP00000032708, Apoptosis (APO-1) Antigen Ligand 1, Fas Ligand, Tumor Necrosis Factor (Ligand) Superfamily, Member 6) (Biotin)

Size

£914.00

SKU:: 207604-BIOTIN
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa172-281 from human FASLG with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLS HKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSS YLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.