207590-HRP

ENSA (Endosulfine alpha, OTTHUMP00000032931, OTTHUMP00000032932, OTTHUMP00000034001, OTTHUMP00000034003, OTTHUMP00000034004, OTTHUMP00000034005, OTTHUMP00000034006, MGC4319, MGC78563, MGC8394) (HRP)

Size

£914.00

SKU:: 207590-HRP
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-121 from full-length human ENSA with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1H7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKL KAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMA KAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSL VTSKLAGGQVE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice