207524-BIOTIN

CAPZB (F-actin-capping Protein Subunit beta, Capping Protein (actin filament) Muscle Z-line beta) CAPB, CAPPB, CAPZ, MGC104401, MGC129749, MGC129750 (Biotin)

Size

£914.00

SKU:: 207524-BIOTIN
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa192-272 from human CAPZB with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4H8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: CAPZB is a member of the F-actin capping protein family. This gene encodes the beta subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLN EIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALK RKQQC Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.