207495-PE
ASAH1 (N-acylsphingosine Amidohydrolase (Acid ceramidase), 1AC, ASAH, FLJ21558, FLJ22079, PHP, PHP32) (PE)
Size
£914.00
- SKU:
- 207495-PE
- Purity:
- Purified
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa25-124 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2C9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKR WHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVD EKLPGLLGNFPGPFEEEMKGIAAVTD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice