207494-APC

ARAF (V-raf Murine Sarcoma 3611 Viral Oncogene Homolog, OTTHUMP00000023212, Oncogene ARAF1, Ras-binding Protein DA-Raf, V-raf Murine Sarcoma 3611 Viral Oncogene Homolog 1, A-RAF, ARAF1, PKS2, RAFA1) (APC)

Size

£927.00

SKU:: 207494-APC
Purity:: Purified
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa151-250 from human ARAF with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G2
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May also regulate the TOR signaling cascade. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.