207492

ARAF (V-raf Murine Sarcoma 3611 Viral Oncogene Homolog, OTTHUMP00000023212, Oncogene ARAF1, Ras-Binding Protein DA-Raf, V-raf Murine Sarcoma 3611 Viral Oncogene Homolog 1, A-RAF, ARAF1, PKS2, RAFA1)

Size

£685.00

SKU:: 207492
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa151-250 from human ARAF with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5H8
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May also regulate the TOR signaling cascade. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.