207461

ABHD5 (Abhydrolase Domain Containing 5, CDS, CGI58, IECN2, MGC8731, NCIE2)

Size

£685.00

SKU:: 207461
Purity:: Purified.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa240-342 from human ABHD5 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B12
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRP MLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPH SYVKTIAILGAGHYVYADQPEEFNQKVK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.