Tim-3, Recombinant, Human (T-cell Immunoglobulin Mucin Receptor 3, T-cell Membrane Protein 3, T-cell and Immunoglobulin and Mucin Domain-containing Protein 3, TIMD-3, Hepatitis A Virus Cellular Receptor 2, HAVCR-2)

Size

£868.00

SKU:: 172357
Molecular Weight:: 46.5
Purity:: ~90%
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 40mM Tris, pH 8.0, 110mM NaCl, 2.4mM KCl, 20% glycerol.
Extra Details:: Human secreted TIM-3, Fc fusion protein, also known as T-cell immunoglobulin mucin receptor 3, T-cell membrane protein 3, T-cell and immunoglobulin and mucin domain-containing protein 3, TIMD-3, Hepatitis A virus cellular receptor 2, and HAVCR-2. Source: Recombinant protein corresponding to aa22-200 from human TIM-3, expressed in HEK293 cell expression system. Molecular Weight: ~46.5kD AA Sequence: SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNY WTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTP APTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRD SGATIRIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHY TQKSLSLSPGK Endotoxin: ≤0.1EU/ug Applications: Suitable for use in studying protein binding and screening small molecules. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Dry Ice