CTLA4, Fc Fusion, Recombinant, Human (Cytotoxic T-lymphocyte-associated Protein 4, CD152)

Size

£656.00

SKU:: 172328
Molecular Weight:: 40.3
Purity:: Highly Purified (~90%)
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 40mM Tris, pH 8.0, 110mM sodium chloride, 2.4mM potassium chloride, 20% glycerol.
Extra Details:: Description: Human secreted CTLA4 , Fc fusion protein, GenBank Accession No. NM_005214, aa36-162 expressed in a HEK293 cell expression system Molecular Weight: ~40.3kD (monomer). This protein runs at a higher MW by SDS-PAGE due to glycosylation. AA Sequence: KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Endotoxin: <0.1EU/ug Applications: Suitable for use in studying protein binding and screening small molecules. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.