CD40, Fc Fusion, Recombinant, Human (Tumor Necrosis Factor Receptor Superfamily Member 5, TNFRSF5, Bp50)

Size

£779.00

SKU:: 172325
Molecular Weight:: 45.9
Purity:: ≥90%. Endotoxin: ≤0.1EU/ug
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol.
Extra Details:: Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion. Recombinant protein corresponding to aa21-193 from human CD40, fused to Fc-fusion tag (Human IgG1), at C-terminal, expressed in HEK293 cell expression system. Molecular Weight: ~45.9kD Amino Acid Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHC HQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQI ATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDR LRDIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK Applications: Suitable for use in studying protein binding and screening small molecules. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Dry Ice