CD28, Fc Fusion, Recombinant, Human (T-Cell-Specific Surface Glycoprotein, TP44)

Size

£836.00

SKU:: 172324
Molecular Weight:: 41.4
Purity:: ~90%
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 8mM PBS pH 7.4, 110mM NaCl, 2.2mM KCl, 20% glycerol.
Extra Details:: Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Product Description: Human secreted CD28-Fc fusion protein (GenBank Accession No. NM_006139), aa 19-152, expressed in a HEK293 cell expression system. Molecular Weight: ~41.4kD (monomer). This protein runs at a higher molecular weight due to glycosylation. Amino Acid Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPDMDPKSCDKTHTCPPCP APELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS VMHEALHNHYTQKSLSLSPGK Note: NKIL..... PSKP: CD28 (aa 19-152) DMD: Linker amino acids PKSC....SPGK: Fc of human IgG1 (aa 100-330) Applications: Suitable for use in studies of protein-protein interaction and in in vitro and in vivo protein function studies. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Dry Ice