CD160, Recombinant, Human (Natural Killer Cell Receptor BY55)

Size

£868.00

SKU:: 172321
Molecular Weight:: 15.6
Purity:: ~90%
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 8mM phosphate, pH 7.4, 110mM NaCl, 2.2mM KCl, 20% glycerol.
Extra Details:: Receptor showing broad specificity for both classical and non-classical MHC class I molecules. Source: Recombinant protein corresponding to aa27-159 from human CD160 at C-terminal, fused to His-tag expressed in HEK293 cell expression system Molecular Weight: ~15.6kD AA Sequence: INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGI DGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLK QRQHLEFSHNEGTLSHHHHHH Endotoxin: ≤0.1EU/ug Applications: Suitable for use in studying protein binding and screening small molecules. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.