CD137, Recombinant, Human, Fc Fusion Protein (Tumor Necrosis Factor Receptor Superfamily Member 9, TNFRSF9, ILA) (Biotin)

Size

£841.00

SKU:: 172320
Molecular Weight:: 45.9
Purity:: ~90%
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol. Labeled with Biotin.
Extra Details:: Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation. Source: Recombinant Fc fusion protein corresponding to aa24-186 from human CD137, expressed in a HEK293 cell expression system. Molecular Weight: ~45.9kD AA Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSS TSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRP WTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQDIEGR MDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GKGGGLNDIFEAQKIEWHE Endotoxin: <0.1EU/ug Applications: Suitable for use in the study of protein binding and screening small molecules. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.