B7-H5, Recombinant, Human (Platelet Receptor Gi24 Dies1, VISTA, SISP1)

Size

£868.00

SKU:: 172316
Molecular Weight:: 46.7
Purity:: ~90%
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 40mM Tris, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol.
Extra Details:: Human secreted B7-H5, Fc fusion protein, also known as Gi24, Dies1, VISTA, and SISP1. Source: Recombinant protein corresponding to aa33-194 from human B7-H5, expressed in HEK293 cell expression system. Molecular Weight: ~46.7kD AA Sequence: FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPI RNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCC LVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAIEGRMDPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* Endotoxin: <0.1EU/ug Applications: Suitable for use in studying protein binding and screening small molecules. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.