B7-H4, Recombinant, Human (B7x, B7S1, B7H4) (Biotin)

Size

£859.00

SKU:: 172314
Molecular Weight:: 28.6
Purity:: ~90%
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 8mM phosphate, pH 7.4, 110mM sodium chloride, 2.2mM KCl, 20% glycerol. Labeled with Biotin.
Extra Details:: Human secreted CD137, Fc fusion protein, also known as Tumor Necrosis Factor Receptor Superfamily member 9, TNFRSF9, and ILA, Recombinant protein corresponding to aa29-258 with C-terminal His-Avi-Tags from human B7-H4, expressed in HEK293 cell expression system. Amino Acid Sequence: FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDE LSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTG AFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSF ELNSEN VTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNS KAHHHHHHHHHHGGGLNDIFEAQKIEWHE Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors and selectivity profiling. Other applications not tested. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.