B7-1, Recombinant, Human, Fc Fusion Protein (CTLA-4 Counter-Receptor B7.1, CD80) (Biotin)

Size

£1,015.00

SKU:: 172312
Molecular Weight:: 52.5
Purity:: ~90%
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 40mM Tris, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol. Labeled with Biotin.
Extra Details:: Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation. Source: Recombinant protein corresponding to aa35-242 from human B7-1, expressed in HEK293 cell expression system. Molecular Weight: ~52.5kD AA Sequence: VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEY KNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFP TPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSS KLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNIEGRMDPKSCDKT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPGKGGGLNDIFEAQKIEWHE* Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling.. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Dry Ice