171996

Sortase A, Recombinant, S. aureus

Size

£1,117.00

SKU:: 171996
Molecular Weight:: 27.1
Purity:: ~80% (SDS-PAGE)
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.
Extra Details:: Recombinant protein corresponding to aa26-206 of Sortase A at the N-terminus, fused to His-tag expressed in E.coli. Molecular Weight: ~21.7kD AA Sequence: MHHHHHH KPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAG YIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDR PNYQFTNLK AAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCD DYNEKT GVWEKRKIFVATEVK Application: Suitable for use with in vitro protein ligation reactions. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap