171906

IDH1, Recombinant, Human (Isocitrate Dehydrogenase, Oxalosuccinate decarboxylase)

Size

£797.00

SKU:: 171906
Molecular Weight:: 48
Purity:: ~70%
Storage Conditions:: -70°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM KCl, 0.04% Tween 20, 20% glycerol.
Extra Details:: Human Isocitrate Dehydrogenase (IDH1), also known as oxalosuccinate decarboxylase, GenBank Accession No. NM_005896, full length [a.a.1-414(end)] with Arg to His mutation on aa132 and C-terminal FLAG-tag, MW= 48kD, expressed in Sf9 cells via a baculovirus expression system. Molecular Weight: ~48kD Specific Activity: 57pmol/min/ug Assay Conditions: IDH reductive activity was measured in 200ul reaction containing 25mM Tris (pH 7.4), 150 mM sodium chloride, 10mM MgCl2, 0.03% BSA, 1mM alpha-Ketoglutarate, 10uM NADPH and IDH. Depletion of NADPH was monitored continuously at 340nm for 20 minutes. Molar extinction coefficient of NADPH is 6,200 M-1cm-1 Application: Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDA TNDQVTKDA AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLV SGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVA MGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQ FEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL DYKDDDDK Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Dry Ice