157200
Tumor Necrosis Factor Alpha (TNFa) Recombinant, Monkey
Size
£366.00
- SKU:
- 157200
- Molecular Weight:
- 21.1
- Purity:
- ≥97%
- Storage Conditions:
- 4°C/-70°C
- Supplier:
- United States Biological
- Format:
- Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.
- Extra Details:
- Source: Recombinant Monkey from E. coli Purity: ≥97% Endotoxin: 1.0EU per 1ug (determined by the LAL method) Accession No: P48094 Fragment: Val77~Leu233 (Accession No: P48094) Sequence: MGSSHHH HHHSSGLVPR GSHMASMTGG QQMGRGSEF-VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRAN ALLANGVELT DNQLVVPSEG LYLIYSQVLF KGQGCPSNHV LLTHTISRIA VSYQTKVNLL SAIKSPCQRE TPEGAEAKPW YEPIYLGGVF QLEKGDRLSA EINLPDYLDF AESGQVYFGI IAL Epitope Tag: N-terminal Tags: His-tag and T7-tag Molecular Weight: 21.1kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
- Shipping Conditions:
- Blue Ice