Sulfite Oxidase (SUOX), Recombinant, Human

Size

£380.00

SKU:: 156906
Molecular Weight:: 57.3
Purity:: ≥95%
Storage Conditions:: 4°C/-70°C
Supplier:: United States Biological
Format:: Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.
Extra Details:: Source: Recombinant Human from E. coli Accession No: P51687 Fragment: Glu80~Pro545 (Accession No: P51687) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-E STHIYTKEEV SSHTSPETGI WVTLGSEVFD VTEFVDLHPG GPSKLMLAAG GPLEPFWALY AVHNQSHVRE LLAQYKIGEL NPEDKVAPTV ETSDPYADDP VRHPALKVNS QRPFNAEPPP ELLTENYITP NPIFFTRNHL PVPNLDPDTY RLHVVGAPGG QSLSLSLDDL HNFPRYEITV TLQCAGNRRS EMTQVKEVKG LEWRTGAIST ARWAGARLCD VLAQAGHQLC ETEAHVCFEG LDSDPTGTAY GASIPLARAM DPEAEVLLAY EMNGQPLPRD HGFPVRVVVP GVVGARHVKW LGRVSVQPEE SYSHWQRRDY KGFSPSVDWE TVDFDSAPSI QELPVQSAIT EPRDGETVES GEVTIKGYAW SGGGRAVIRV DVSLDGGLTW QVAKLDGEEQ RPRKAWAWRL WQLKAPVPAG QKELNIVCKA VDDGYNVQPD TVAPIWNLRG VLSNAWHRVH VYVSP Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 57.3kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.

Shipping Conditions:: Blue Ice