155440
Interleukin 6 (IL6) Recombinant, Monkey
Size
£342.00
- SKU:
- 155440
- Molecular Weight:
- 24.9
- Purity:
- ≥95%
- Storage Conditions:
- 4°C/-70°C
- Supplier:
- United States Biological
- Format:
- Supplied as lyophilized powder from 20mM Tris, 150mM sodium chloride, pH 8.0, 1mM EDTA, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile 20mM Tris, 150mM sodium chloride, pH 8.0 to a concentration of 0.1-1mg/ml. Do not vortex.
- Extra Details:
- Source: Recombinant Monkey from E. coli Accession No: P51494 Fragment: Pro27~Met212 (Accession No: P51494) Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-PAPV LPGEDSKNVA APHSQPLTSS ERIDKHIRYI LDGISALRKE TCNRSNMCES SKEALAENNL NLPKMAEKDG CFQSGFNEDT CLVKIITGLL EFEVYLEYLQ NRFESSEEQA RAVQMSTKVL IQFLQKKAKN LDAITTPEPT TNASLLTKLQ AQNQWLQDMT THLILRSFKE FLQSNLRALR QM Epitope Tag: N-terminal His-tag Molecular Weight: 24.9kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile 20mM Tris, 150mM sodium chloride, pH 8.0.. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
- Shipping Conditions:
- Blue Ice