Fibrinogen Beta (FGb) Recombinant, Rat

Size

£366.00

SKU:: 154565
Molecular Weight:: 56.4
Purity:: ≥95%
Storage Conditions:: 4°C/-70°C
Supplier:: United States Biological
Format:: Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.
Extra Details:: Source: Recombinant Rat from E. coli Accession No: Fragment: Gly33~Gln479 (Accession No: ) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-GHRPVDRR KEEPPSLRPA PPPISGGGYR ARPAKVDAGQ KKVERKPPDA GGCVHGDGDM GVLCPTGCEL RQTLLNHERP IKNSIAELNS NINSVSETSS VTFQYLTLLK DMWKKKQAQV KDNENVINEY SSILEDQKLY IDETVNDNIP LNLRVLRSIL EDLRSKIQKL ESDISAQTEY CHTPCTVNCN IPVVSGKECE EIIRKGGETS EMYLIQPDTS SKPYRVYCDM KTENGGWTVI QNRQDGSVDF GRKWDPYKKG FGNIATNEDT KKYCGLPGEY WLGNDKISQL TRIGPTELLI EMEDWKGDKV KAHYGGFTVQ TEANKYQVSV NKYKGTAGNA LMEGASQLVG ENRTMTIHNG MFFSTYDRDN DGWVTTDPRK QCSKEDGGGW WYNRCHAANP NGRYYWGGLY SWDMSKHGTD DGVVWMNWKG SWYSMRRMSM KIRPVFPQQ Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 56.4kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.

Shipping Conditions:: Blue Ice