Cluster Of Differentiation 4 (CD4) Recombinant, Monkey

Size

£384.00

SKU:: 154024
Molecular Weight:: 46.5
Purity:: ≥95%
Storage Conditions:: 4°C/-70°C
Supplier:: United States Biological
Format:: Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.
Extra Details:: Source: Recombinant Monkey from E. coli Accession No: P16003 Fragment: Lys26~Pro396 (Accession No: P16003) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-KKVVL GKKGDTVELT CNASQKKNTQ FHWKNSNQIK ILGIQGLFLT KGPSKLSDRA DSRKSLWDQG CFSMIIKNLK IEDSDTYICE VENKKEEVEL LVFGLTANSD THLLEGQSLT LTLESPPGSS PSVKCRSPGG KNIQGGRTIS VPQLERQDSG TWTCTVSQDQ KTVEFKIDIV VLAFQKASST VYKKEGEQVE FSFPLAFTLE KLTGSGELWW QAERASSSKS WITFDLKNKE VSVKRVTQDP KLQMGKKLPL HLTLPQALPQ YAGSGNLTLA LEAKTGKLHQ EVNLVVMRAT QFQENLTCEV WGPTSPKLTL SLKLENKGAT VSKQAKAVWV LNPEAGMWQC LLSDSGQVLL ESNIKVVPTW PTPVQP Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 46.5kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.

Shipping Conditions:: Blue Ice