153876
Caspase 3 (CASP3) Recombinant, Rat
Size
£418.00
- SKU:
- 153876
- Molecular Weight:
- 20.3
- Purity:
- ≥95%
- Storage Conditions:
- 4°C/-70°C
- Supplier:
- United States Biological
- Format:
- Supplied as lyophilized powder from 100mM sodium bicarbonate, 500mM sodium chloride, pH 8.3, 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% trehalose, 0.05% Proclin 300. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml. Do not vortex.
- Extra Details:
- Source: Recombinant Rat from E. coli Accession No: P55213 Fragment: Ser29~Asp175 (Accession No: P55213) Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SG IYLDSSYKMD YPEMGLCIII NNKNFHKSTGMSARNGTDVD AANLRETFMA LKYEVRNKND LTREEIMELM DSVSKEDHSK RSSFVCVILS HGDEGVIFGT NGPVDLKKLT SFFRGDYCRS LTGKPKLFII QACRGTELDC GIETD Epitope Tag: N-terminal Tags: His-tag and T7-tag Molecular Weight: 20.3kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
- Shipping Conditions:
- Blue Ice