153543
Anterior Gradient Protein 2 (AGR2) Recombinant, Mouse
Size
£364.00
- SKU:
- 153543
- Molecular Weight:
- 23.6
- Purity:
- ≥95%
- Storage Conditions:
- -70°C
- Supplier:
- United States Biological
- Format:
- Supplied as lyophilized powder from 20mM Tris,, 50mM sodium chloride, pH 8.0, 0.01% sarcosyl, 5% trehalose. Reconstitute with 20mM Tris, 150mM sodium chloride, pH 8.0 to a concentration of 0.1-1mg/ml. Do not vortex.
- Extra Details:
- Recombinant protein corresponding to aa21-175 of mouse Anterior Gradient Protein 2 with a N-terminal His-tag expressed in E. coli. Swiss/UniProt Accession: O88312 Purity: ≥95% Amino Acid Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-KDTTVKSGAK KDPKDSRPKL PQTLSRGWGD QLIWTQTYEE ALYRSKTSNR PLMVIHHLDE CPHSQALKKV FAEHKEIQKL AEQFVLLNLV YETTDKHLSPDGQYVPRIVF VDPSLTVRAD ITGRYSNRLY AYEPSDTALL YDNMKKALKL LKTEL Molecular Weight: 23.6kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C..Reconstitute with sterile 20mM Tris, 150mM sodium chloride, pH 8.0. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
- Shipping Conditions:
- Blue Ice