TMED4 (Transmembrane emp24 Domain-containing Protein 4, Endoplasmic Reticulum Stress-response Protein 25, ERS25, GMP25iso, Putative NF-kappa-B-activating Protein 156, p24 Family Protein alpha-3, p24alpha3, ERS25) (APC)

Size

£1,000.00

SKU:: 138440-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: N-terminus of TMED4 corresponding to LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.